PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10008922m
Common NameCICLE_v10008922mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GRF
Protein Properties Length: 323aa    MW: 36495.5 Da    PI: 8.9966
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10008922mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.47e-2586129144
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                      d+epgrCrRtDGKkWRCs+++++++k+CErH+hrg++rsrk++e
  Ciclev10008922m  86 DPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVE 129
                      79***************************************987 PP

2QLQ591.4e-201549236
              QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                     +FTa+Q+q+L++Q+l++Ky++++ PvPp+Ll+ i+
  Ciclev10008922m 15 PFTASQWQELEHQALIFKYMVSGIPVPPDLLFTIK 49
                     8******************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009514.2E-121450IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088808.6E-161548IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.5851550IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.71986130IPR014977WRC domain
PfamPF088791.1E-2087129IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MNNGNHNMSA INRFPFTASQ WQELEHQALI FKYMVSGIPV PPDLLFTIKR SYYFDRSPPS  60
AAKHFTHQHQ HVEWNCFQVG LGRKIDPEPG RCRRTDGKKW RCSKEAYPDS KYCERHMHRG  120
KNRSRKPVEL NTSTCTANKS SSALFYSSAK HQESFNLTHL VLDSGSGSGS GSQSNTDLRS  180
RYVYGPKEEV DEHAFFSEPS GKVRSFSAVS MDDSWQLTPL TMSSSCSSSS SKQRSFSGLQ  240
SDYSDLQLKS CADNKPKQQD KQPEEIPQKT VHRFFDEWPP KSRDSWLDLD DKSSKNASLS  300
TTSLSISIPS SHDFPIFSSR AP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1826628e-50AC182662.2 Populus trichocarpa clone Pop1-15O24, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006451560.10.0hypothetical protein CICLE_v10008922mg
RefseqXP_006490822.10.0PREDICTED: growth-regulating factor 6 isoform X1
TrEMBLV4UKN20.0V4UKN2_9R
STRINGPOPTR_0018s07140.11e-131(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM45672651
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.14e-53growth-regulating factor 5